DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and CG5246

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:272 Identity:78/272 - (28%)
Similarity:123/272 - (45%) Gaps:59/272 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 HLALVLPSSSSKTRIVGGKETTISEVPYLVYLRQN-GYFICGGSLISSRAVLSAAHC-------- 67
            ||..|.|    :||::||.::.....||.|.:... |..:||||:|:.:.:|:||||        
  Fly    32 HLGHVKP----ETRVIGGVDSPTGFAPYQVSIMNTFGEHVCGGSIIAPQWILTAAHCMEWPIQYL 92

  Fly    68 --VYG----SQP------EGFTVHAGASRLDQEAPVVRNVVMFHTSPSYSATNFDMDVALLQLQE 120
              |.|    ::|      :|..:|..                 |..|:|     ..|:||:...:
  Fly    93 KIVTGTVDYTRPGAEYLVDGSKIHCS-----------------HDKPAY-----HNDIALIHTAK 135

  Fly   121 VVV---LT-PGKVATISPCRNPPEGNAYARISGWGVTRENNREPAEQVRTTMVRVLPGAECKISY 181
            .:|   || |.|:|  |....|..|:... ::|||.|:...|. :.|::...:..:....|:...
  Fly   136 PIVYDDLTQPIKLA--SKGSLPKVGDKLT-LTGWGSTKTWGRY-STQLQKIDLNYIDHDNCQSRV 196

  Fly   182 SGYGQLSDSMLCAAVRGLRDSCSGDSGGPLVYRGQ-VCGIVSWGFGCARPSFPGVYTNVASERVH 245
            .....||:..:|...:....||.||||||||...| :.|:|:||..|| ..:|.|:.:||  ..|
  Fly   197 RNANWLSEGHVCTFTQEGEGSCHGDSGGPLVDANQTLVGVVNWGEACA-IGYPDVFGSVA--YYH 258

  Fly   246 EFIEQTLRRIGS 257
            ::|||.:...|:
  Fly   259 DWIEQMMTDAGT 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 67/241 (28%)
Tryp_SPc 26..251 CDD:238113 70/250 (28%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 69/248 (28%)
Tryp_SPc 42..263 CDD:238113 69/249 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.