DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and CG4053

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster


Alignment Length:273 Identity:67/273 - (24%)
Similarity:119/273 - (43%) Gaps:34/273 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VGLRLLWWLCHLALVLPSSSSKT-------------RIVGGKETTISEVPYLVYLRQN-GYFICG 52
            |.|.|:|     .|:|.:|...|             |||||:|......||.|.::.. ...||.
  Fly     3 VRLSLIW-----LLLLGTSIDVTRGKRLDNRKLLDNRIVGGQEAEDGVAPYQVSIQTIWKTHICS 62

  Fly    53 GSLISSRAVLSAAHCVYGSQPEGFTVHAGAS-RLDQEAPVVRNVVMFHT--SPSYSATNFDMDVA 114
            |.:::.:.:|:|.||......|...:..|.: ||:....:..:..:.|.  ...|...|   |:|
  Fly    63 GVILNEQWILTAGHCALDFSIEDLRIIVGTNDRLEPGQTLFPDEALVHCLYDIPYVYNN---DIA 124

  Fly   115 LLQLQEVVVLTPGKVATISPCRNPPEGNAYARISGWGVTRENNREPAEQVRTTMVRVLPGAECKI 179
            |:.:.|.::.. .:...:...|..|...:...::|||.. |::....:.::|..:.::...||:.
  Fly   125 LIHVNESIIFN-DRTQIVELSREQPPAGSTVTLTGWGAP-ESSYPTVQYLQTLNLTIIAHEECRE 187

  Fly   180 SYSGYGQLSDSMLCAAVRGLRDSCSGDSGGPLVYRGQVCGIVSWGFGCARPSFPGVYTNVASERV 244
            .:..:..:....:|...|....:|||||||||::.|::.|:|:||..|. ...|.:|.|..    
  Fly   188 RWDFHDGIDIGHICTFTREGEGACSGDSGGPLMWEGKLVGLVNWGRACG-VGMPDMYANTV---- 247

  Fly   245 HEFIEQTLRRIGS 257
              :.:..:||..|
  Fly   248 --YYQDWIRRTHS 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 56/219 (26%)
Tryp_SPc 26..251 CDD:238113 55/228 (24%)
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 56/230 (24%)
Tryp_SPc 35..256 CDD:238113 56/232 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.