DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and CG10405

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster


Alignment Length:252 Identity:89/252 - (35%)
Similarity:136/252 - (53%) Gaps:21/252 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LALVLPSSSSK--------TRIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAHCVY 69
            :.::|.:|.::        :|||.|:|.|..:.||.:.||:....|||.|::||...::||||:.
  Fly    16 ILVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITAAHCID 80

  Fly    70 G--SQPEGFTVHAGASRLDQEAPVVRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTP-GKVAT 131
            |  .||..||:..| |.:......|:.|...:..|:|...:.:.|||||:..:..:..| |||| 
  Fly    81 GHEQQPREFTLRQG-SIMRTSGGTVQPVKAIYKHPAYDRADMNFDVALLRTADGALSLPLGKVA- 143

  Fly   132 ISPCRNPPEGNAY-----ARISGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGYGQLSDSM 191
              |.|.|..|.|.     |.:||||....:|...:..:::|.|..:...:|......:|.::::|
  Fly   144 --PIRLPTVGEAISESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHNDLRHHGGVTEAM 206

  Fly   192 LCAAVRGLRDSCSGDSGGPLVYRGQVCGIVSWGFGCARPSFPGVYTNVASERVHEFI 248
            .|||.|. .|:|.||||||:..:|.:.||||||.|||.|.:|||||.:|...:..:|
  Fly   207 FCAAARN-TDACQGDSGGPISAQGTLIGIVSWGVGCADPYYPGVYTRLAHPTIRRWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 85/223 (38%)
Tryp_SPc 26..251 CDD:238113 86/231 (37%)
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 86/230 (37%)
Tryp_SPc 37..263 CDD:238113 86/231 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D114140at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.