DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and Tmprss11c

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001003979.1 Gene:Tmprss11c / 408213 RGDID:1302967 Length:418 Species:Rattus norvegicus


Alignment Length:252 Identity:77/252 - (30%)
Similarity:120/252 - (47%) Gaps:28/252 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LVLPSSSSK-------------TRIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAH 66
            |::.|||.|             .::.||::....|.|:...|:||....||.:|||:..:::|||
  Rat   163 LLIDSSSFKFSGCGRRTITPGGHKVAGGQDAEEGEWPWQASLQQNNVHRCGATLISNSWLITAAH 227

  Fly    67 C-VYGSQPEGFTVHAGASRLDQEAPVVRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTPGKVA 130
            | |..:.|:.:.|..|......:|......::.|.:.||.|.|  .|:|:::|...|:.......
  Rat   228 CFVRSANPKDWKVSFGFLLSKPQAQRAVKSIVIHENYSYPAHN--NDIAVVRLSSPVLYENNIRR 290

  Fly   131 TISP---CRNPPEGNAYARISGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGYGQLSDSML 192
            ...|   .:.||  |:...::|||..:.:...| ..::...|:::....|....:..|.::..||
  Rat   291 ACLPEATQKFPP--NSDVVVTGWGTLKSDGDSP-NILQKGRVKIIDNKTCNSGKAYGGVITPGML 352

  Fly   193 CAA-VRGLRDSCSGDSGGPLVYRGQ-----VCGIVSWGFGCARPSFPGVYTNVASER 243
            ||. :.|..|:|.||||||||....     :.||||||..||.|:.|||||.|...|
  Rat   353 CAGFLEGRVDACQGDSGGPLVSEDSKGIWFLAGIVSWGDECALPNKPGVYTRVTHYR 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 71/225 (32%)
Tryp_SPc 26..251 CDD:238113 72/228 (32%)
Tmprss11cNP_001003979.1 SEA 62..157 CDD:279699
Tryp_SPc 186..412 CDD:214473 72/229 (31%)
Tryp_SPc 187..415 CDD:238113 72/228 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.