DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and CG10587

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001137989.2 Gene:CG10587 / 40318 FlyBaseID:FBgn0037039 Length:289 Species:Drosophila melanogaster


Alignment Length:257 Identity:93/257 - (36%)
Similarity:141/257 - (54%) Gaps:22/257 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LALVLPSSSSKTRIVGGKETTISEV-PYLVYLRQNGYFICGGSLISSRAVLSAAHCVYGS-QPEG 75
            ||.::.....:||:|||..||.::: .||:.||....|:|||:|:....||:||||..|. :...
  Fly    33 LAKIVQRPGFQTRVVGGDVTTNAQLGGYLIALRYEMNFVCGGTLLHDLIVLTAAHCFLGRVKISD 97

  Fly    76 FTVHAGASRLDQEAPVVRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTPGK-VATISPCRNPP 139
            :....|||:|:... :.|.|.....|..:...:.:||||:|:|::.:   .|| :..:..|:...
  Fly    98 WLAVGGASKLNDRG-IQRQVKEVIKSAEFREDDMNMDVAILRLKKPM---KGKSLGQLILCKKQL 158

  Fly   140 EGNAYARISGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGYG-------------QLSDSM 191
            ......|:||||:|..:...|.:.:||..|.|:...:|:.||....             .|:|||
  Fly   159 MPGTELRVSGWGLTENSEFGPQKLLRTVTVPVVDKKKCRASYLPTDWESHKHFDLFLKVHLTDSM 223

  Fly   192 LCAAVRGLRDSCSGDSGGPLVYRGQVCGIVSWGFGCARPSFPGVYTNVASERVHEFIEQTLR 253
            .||.|.|.:|:|:.||||||||:.|||||||:|.|||...:.||||::.  .|..||||:::
  Fly   224 FCAGVLGKKDACTFDSGGPLVYKNQVCGIVSFGIGCASKRYYGVYTDIM--YVKPFIEQSIK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 85/231 (37%)
Tryp_SPc 26..251 CDD:238113 88/240 (37%)
CG10587NP_001137989.2 Tryp_SPc 45..278 CDD:214473 86/238 (36%)
Tryp_SPc 46..280 CDD:238113 87/239 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.