DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and CG11037

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_649272.1 Gene:CG11037 / 40317 FlyBaseID:FBgn0037038 Length:292 Species:Drosophila melanogaster


Alignment Length:258 Identity:97/258 - (37%)
Similarity:150/258 - (58%) Gaps:13/258 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GLRLLWWLCHLALVLPSSSSKTRIVGGKETTISEV-PYLVYLRQNGYFICGGSLISSRAVLSAAH 66
            |..|...:..||.::..|..:||::||..||.::: .||..|.....|:|||:|::...||:|||
  Fly    39 GKNLTLDVAQLAKIVLPSPHETRVIGGHVTTNAKLGGYLTALLYEDDFVCGGTLLNENIVLTAAH 103

  Fly    67 CVYG-SQPEGFTVHAGASRLDQEAPVVRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTPGK-- 128
            |..| .:...:.|.||.|.|:|:. :.|:|..|..|..:...:.:||||:     |::.||.|  
  Fly   104 CFLGRMKASEWIVAAGISNLNQKG-IRRHVKDFILSEQFREDDMNMDVAV-----VLLKTPLKAK 162

  Fly   129 -VATISPCRNPPEGNAYARISGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGYGQLSDSML 192
             :.|:|.|....:......:||||:|....|.|...:||..|.::....|:.:|....:::|||:
  Fly   163 NIGTLSLCSVSLKPGVELVVSGWGMTAPRGRGPHNLLRTVTVPIIHKKNCRAAYQPTAKITDSMI 227

  Fly   193 CAAVRGLRDSCSGDSGGPLVYRGQVCGIVSWGFGCARPSFPGVYTNVASERVHEFIEQTLRRI 255
            ||||.|.:|:|:.|||||||::.|||||||:|.|||...:|||||:|.  .|..|||::::.:
  Fly   228 CAAVLGRKDACTFDSGGPLVFKKQVCGIVSFGIGCASNRYPGVYTDVM--YVKPFIEKSIKAL 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 87/220 (40%)
Tryp_SPc 26..251 CDD:238113 90/229 (39%)
CG11037NP_649272.1 Tryp_SPc 61..281 CDD:214473 88/227 (39%)
Tryp_SPc 62..283 CDD:238113 89/228 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455609
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.