DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and Sems

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster


Alignment Length:244 Identity:97/244 - (39%)
Similarity:143/244 - (58%) Gaps:10/244 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LVLPSSSSKTRIVGGKETTISEV-PYLVYLRQNGYFICGGSLISSRAVLSAAHCVYG-SQPEGFT 77
            :||| .:.:||::||:.||.::: .|||.:|....|||||:||....||:||||... ::.|.::
  Fly    34 IVLP-PAYQTRVIGGRVTTNAKLGGYLVAMRYFNNFICGGTLIHELIVLTAAHCFEDRAEKEAWS 97

  Fly    78 VHAGASRLDQEAPVVRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTPGK-VATISPCRNPPEG 141
            |..|.|||.::. :.|.|..|..|..:.....:||||::.|...:|   || :.|:|.|......
  Fly    98 VDGGISRLSEKG-IRRQVKRFIKSAQFKMVTMNMDVAVVLLNRPMV---GKNIGTLSLCSTALTP 158

  Fly   142 NAYARISGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGYGQLSDSMLCAAVRGLRDSCSGD 206
            .....:||||:|..::..|...:||..|.|:....|:.:|.....:||||.||:|.|.:|:|:.|
  Fly   159 GQTMDVSGWGMTNPDDEGPGHMLRTVSVPVIEKRICREAYRESVSISDSMFCASVLGKKDACTYD 223

  Fly   207 SGGPLVYRGQVCGIVSWGFGCARPSFPGVYTNVASERVHEFIEQTLRRI 255
            |||||||..|||||||:|.|||...:|||||:|  ..|..||.:.::.:
  Fly   224 SGGPLVYEKQVCGIVSFGIGCASRRYPGVYTDV--HYVKPFIVKGIKAL 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 90/218 (41%)
Tryp_SPc 26..251 CDD:238113 92/227 (41%)
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 91/225 (40%)
Tryp_SPc 44..265 CDD:238113 92/226 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455610
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.