DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and CG10663

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster


Alignment Length:235 Identity:76/235 - (32%)
Similarity:113/235 - (48%) Gaps:20/235 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SSSSKTRIVGGKETTISEVPYLV-YLRQNGYFICGGSLISSRAVLSAAHCVYGSQPEGFTVHAGA 82
            |.|:..:|:||:.....|.|:.| .|.:.....|||:||:.|.||:|||||    .:...|..|.
  Fly   500 SMSNMLKIIGGRAARKGEWPWQVAILNRFKEAFCGGTLIAPRWVLTAAHCV----RKVLFVRIGE 560

  Fly    83 SRLDQE--APVVRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTP--GKVATISPCRNPPEGNA 143
            ..|:.|  ..:...|:..:|.|::.....|.|||||:|.:.|..|.  |......|.:..|: |.
  Fly   561 HNLNYEDGTEIQLRVMKSYTHPNFDKRTVDSDVALLRLPKAVNATTWIGYSCLPQPFQALPK-NV 624

  Fly   144 YARISGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGYGQLSDSMLCAA-VRGLRDSCSGDS 207
            ...|.|||..|..:......:....|.::|...|:..|..| .::.:|.||. .:|..|:|:|||
  Fly   625 DCTIIGWGKRRNRDATGTSVLHKATVPIIPMQNCRKVYYDY-TITKNMFCAGHQKGHIDTCAGDS 688

  Fly   208 GGPLVYRG--------QVCGIVSWGFGCARPSFPGVYTNV 239
            ||||:.|.        .:.||.|:|.|||:.:..|:|..|
  Fly   689 GGPLLCRDTTKPNHPWTIFGITSFGDGCAQRNKFGIYAKV 728

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 74/229 (32%)
Tryp_SPc 26..251 CDD:238113 74/228 (32%)
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 74/229 (32%)
Tryp_SPc 507..735 CDD:238113 74/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455712
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.