DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and CG32271

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster


Alignment Length:251 Identity:107/251 - (42%)
Similarity:150/251 - (59%) Gaps:13/251 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LWWLCHLALVLP-----SSSSKTRIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAH 66
            ||.:.||   :|     |:.:.:|||||....|:.|||||.||..|.|:|||||::.:.|::|||
  Fly     4 LWLVLHL---IPLCWAASNEANSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAH 65

  Fly    67 CVYGSQPEGFTVHAGASRLDQEAPVVRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTPGKVAT 131
            ||.|.......|.||.:|| .|..|...|...:|..:|:......|||:|:|:  ..::..||:|
  Fly    66 CVKGIGASRILVVAGVTRL-TETGVRSGVDKVYTPKAYNTRTLTSDVAVLKLK--APISGPKVST 127

  Fly   132 ISPCRNPPEGNAYARISGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGYGQLSDSMLCAAV 196
            |..|....:.....::||||...|.|:..:.|||:..|.::|...|...|...|.::::|.||:|
  Fly   128 IELCNTSFKAGDLIKVSGWGQITERNKAVSMQVRSVDVALIPRKACMSQYKLRGTITNTMFCASV 192

  Fly   197 RGLRDSCSGDSGGPLVYRGQVCGIVSWGFGCARPSFPGVYTNVASERVHEFIEQTL 252
            .|::|:|.||||||.||:||:|||||||.||||.|.|||||||  :.|..||::.|
  Fly   193 PGVKDACEGDSGGPAVYQGQLCGIVSWGVGCARKSSPGVYTNV--KTVRSFIDKAL 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 97/215 (45%)
Tryp_SPc 26..251 CDD:238113 99/224 (44%)
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 98/222 (44%)
Tryp_SPc 25..244 CDD:238113 99/223 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455611
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D114140at6656
OrthoFinder 1 1.000 - - FOG0003271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.