DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and Ser8

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster


Alignment Length:263 Identity:90/263 - (34%)
Similarity:142/263 - (53%) Gaps:34/263 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VGLRLLWWLCHLAL----VLP------SSSSKTRIVGGKETTISEVPYLVYLRQNGYFICGGSLI 56
            :.|.:..:|..|||    |:|      :||...|||||..::|.:.|:.|.|:::|...||||:|
  Fly     1 MSLLIATFLALLALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSII 65

  Fly    57 SSRAVLSAAHCVYGSQP---EGFTVHAGASRLDQEAPVVRNVVMFHTSPSYSATNFDMDVALLQL 118
            |:..:::||||:  ..|   ....:.||:::......:| .|.......:|::.:...|:.:::|
  Fly    66 SNNIIVTAAHCL--DTPTTVSNLRIRAGSNKRTYGGVLV-EVAAIKAHEAYNSNSKINDIGVVRL 127

  Fly   119 QEVVVLTPG---KVATISPCRNPPEGNAYARISGWGVTRENNREPAEQVRTTMV----RVLPGAE 176
            :  ..||.|   |..|::.. .|..|:| |.|||||.|..:....|     |::    |::..::
  Fly   128 K--TKLTFGSTIKAITMASA-TPAHGSA-ASISGWGKTSTDGPSSA-----TLLFVDTRIVGRSQ 183

  Fly   177 CKISYSGYGQ-LSDSMLCAAVRGLRDSCSGDSGGPLVYRGQVCGIVSWGFGCARPSFPGVYTNVA 240
            |..|..|||. :..:|:|||... :|:|.||||||||..||:.|:||||..||..::||||.|:|
  Fly   184 CGSSTYGYGSFIKATMICAAATN-KDACQGDSGGPLVSGGQLVGVVSWGRDCAVANYPGVYANIA 247

  Fly   241 SER 243
            ..|
  Fly   248 ELR 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 79/226 (35%)
Tryp_SPc 26..251 CDD:238113 80/229 (35%)
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 81/230 (35%)
Tryp_SPc 35..253 CDD:238113 80/229 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D114140at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.