DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and thetaTry

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster


Alignment Length:232 Identity:82/232 - (35%)
Similarity:120/232 - (51%) Gaps:26/232 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RIVGGKETTISEVPYLVYLR-QNGYFICGGSLISSRAVLSAAHCVYGSQPEGFTVHAGASRLDQE 88
            |||||::|||...||.|.|: ::|...||||||:...|::||||:.|.:.....|..| |.|..|
  Fly    34 RIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTVVTAAHCLVGRKVSKVFVRLG-STLYNE 97

  Fly    89 APVVRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTPG----KVATISPCRNPPEGNAYARISG 149
            ..:|..|.....:..|::...:.||.:|:|.|.|..|..    ::||    ..||.|.. |.::|
  Fly    98 GGIVVAVRELAYNEDYNSKTMEYDVGILKLDEKVKETENIRYIELAT----ETPPTGTT-AVVTG 157

  Fly   150 WG-------VTRENNREPAEQVRTTMVRVLPGAECKISYSGYGQ-LSDSMLCAAVRGLRDSCSGD 206
            ||       :|.      .:.::...|.::....|......||: :.|||:||..: .:|:|.||
  Fly   158 WGSKCYFWCMTL------PKTLQEVYVNIVDWKTCASDEYKYGEIIYDSMVCAYEK-KKDACQGD 215

  Fly   207 SGGPLVYRGQVCGIVSWGFGCARPSFPGVYTNVASER 243
            |||||.....:.||||||:.||....||||::|.:.|
  Fly   216 SGGPLAVGNTLVGIVSWGYACASNLLPGVYSDVPALR 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 81/228 (36%)
Tryp_SPc 26..251 CDD:238113 81/231 (35%)
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 82/232 (35%)
Tryp_SPc 35..255 CDD:238113 81/231 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D114140at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.