DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and etaTry

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster


Alignment Length:251 Identity:96/251 - (38%)
Similarity:135/251 - (53%) Gaps:22/251 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LRLLWWLCHLALVLPSSSSKTRIVGGKETTISEVPYLVYLRQ-----NGYF-ICGGSLISSRAVL 62
            ||:|..|..|.:...|:.|..|||||.:|:.....|:|.||:     :.|. .|||.::.:..:.
  Fly     6 LRILAVLFLLGIYAVSAQSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVTIA 70

  Fly    63 SAAHCVYGSQPEGFTVHAG-ASRLDQEAPVVRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTP 126
            :||||||..:.|.|.|.|| .||......||| |........|:::..|.|:||     |||..|
  Fly    71 TAAHCVYNREAENFLVVAGDDSRGGMNGVVVR-VSKLIPHELYNSSTMDNDIAL-----VVVDPP 129

  Fly   127 ------GKVATISPCRNPPEGNAYARISGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGYG 185
                  ..:..|......|.....|.|||||.|:||... ::|::...|.::...:|:.:|. :.
  Fly   130 LPLDSFSTMEAIEIASEQPAVGVQATISGWGYTKENGLS-SDQLQQVKVPIVDSEKCQEAYY-WR 192

  Fly   186 QLSDSMLCAAV-RGLRDSCSGDSGGPLVYRGQVCGIVSWGFGCARPSFPGVYTNVA 240
            .:|:.||||.: .|.:|:|.||||||||...::.||||||.|||||::||||.|||
  Fly   193 PISEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEGCARPNYPGVYANVA 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 89/230 (39%)
Tryp_SPc 26..251 CDD:238113 88/229 (38%)
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 89/230 (39%)
Tryp_SPc 28..257 CDD:238113 88/229 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455641
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D114140at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.