DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and lambdaTry

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster


Alignment Length:235 Identity:87/235 - (37%)
Similarity:129/235 - (54%) Gaps:16/235 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAHCVYG-SQPEGFTVHAGASRL--- 85
            |||||::|.|::.|:.:.:|..|...|||::..|..::||||||.. |.||..|:.||:|.:   
  Fly    35 RIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNIWFP 99

  Fly    86 --DQEAPVVRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTPGKVATISPCRNPPEGNAYARIS 148
              .|:...||.:::   .|.|...|.|.|.|:|.|......... |..|...:..|:.:....::
  Fly   100 TGPQQELEVREIII---HPKYRTLNNDYDAAILILDGDFEFNDA-VQPIELAKERPDHDTPVTVT 160

  Fly   149 GWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGYGQLSDSMLCAAVR-GLRDSCSGDSGGPLV 212
            |||.|.|.. ..::.::...|.|:..:.||.:||  ..|:..||||.|. |.:|:|.||||||||
  Fly   161 GWGTTSEGG-TISDVLQEVSVNVVDNSNCKNAYS--IMLTSRMLCAGVNGGGKDACQGDSGGPLV 222

  Fly   213 YRGQVCGIVSWGFGCARPSFPGVYTNVASERVHEFIEQTL 252
            |...:.||||||.||||..:||||.:|..  |.:::.:|:
  Fly   223 YNNTLLGIVSWGTGCAREKYPGVYCSVPD--VLDWLVETV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 85/222 (38%)
Tryp_SPc 26..251 CDD:238113 85/231 (37%)
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 86/228 (38%)
Tryp_SPc 36..259 CDD:238113 85/231 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D114140at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.