DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and PRSS53

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:XP_011544118.1 Gene:PRSS53 / 339105 HGNCID:34407 Length:623 Species:Homo sapiens


Alignment Length:286 Identity:73/286 - (25%)
Similarity:103/286 - (36%) Gaps:94/286 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 TTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAHC--------------VYGS-QPEGFTVHAG 81
            |...|.|:...:|:.|..||.|||::...||:||||              |.|| |.||.:  .|
Human    43 TVPGEWPWQASVRRQGAHICSGSLVADTWVLTAAHCFEKAAATELNSWSVVLGSLQREGLS--PG 105

  Fly    82 ASRLDQEAPVVRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTPGKVATISPCRNPPEGNAYAR 146
            |..:        .|.......:|:..:...|:|||||......||  :....|....|.| |...
Human   106 AEEV--------GVAALQLPRAYNHYSQGSDLALLQLAHPTTHTP--LCLPQPAHRFPFG-ASCW 159

  Fly   147 ISGW----------------------GVT---------------RENNREPAEQ-------VRTT 167
            .:||                      .||               |.....||..       :|..
Human   160 ATGWDQDTSDGKCWPRLKLGEALCLPSVTVSAPNCPGFQSPLLPRSQTLAPAPSLSPAPGTLRNL 224

  Fly   168 MVRVLPGAECKISYSGYGQ--LSD----SMLCAAVR-GLRDSCSGDSGGPLVYRGQVC------- 218
            .:|::....|...|:...|  ||:    .|||...: |::..|.||||||:     :|       
Human   225 RLRLISRPTCNCIYNQLHQRHLSNPARPGMLCGGPQPGVQGPCQGDSGGPV-----LCLEPDGHW 284

  Fly   219 ---GIVSWGFGCARPSFPGVYTNVAS 241
               ||:|:...||:...|.:.||.|:
Human   285 VQAGIISFASSCAQEDAPVLLTNTAA 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 72/284 (25%)
Tryp_SPc 26..251 CDD:238113 73/286 (26%)
PRSS53XP_011544118.1 Tryp_SPc 42..316 CDD:238113 73/286 (26%)
Tryp_SPc 43..314 CDD:214473 73/286 (26%)
Tryp_SPc 359..>512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.