DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and Send1

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster


Alignment Length:232 Identity:77/232 - (33%)
Similarity:115/232 - (49%) Gaps:21/232 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LVLPSSSSKTRIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAHCVYGSQPEG-FTV 78
            |:.||.    ||:||....|::||:.|.|:..|...||||:.|...:::||||:    .|| .::
  Fly    23 LLEPSE----RIIGGSSMDITDVPWQVSLQYYGEHFCGGSIYSKTIIITAAHCI----KEGERSI 79

  Fly    79 HAGASRLDQEAPVVRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTPGKVATISPCRNPPEGNA 143
            .||:| |.....||..|..:...|.:...|.:.|||:|:|...:..: ..:.||......|..::
  Fly    80 RAGSS-LHDSGGVVVGVEAYIIHPQFDKHNMENDVAVLKLSSPLSFS-DSIQTIPLAETDPPTSS 142

  Fly   144 YARISGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGYGQLSDSMLCAAVRGLRDSCSGDSG 208
            .|..:|||  |.|......|::...:.:.|...||:.| |.|..::. :||...| :..|.||||
  Fly   143 SALATGWG--RGNFLIRPRQLQGVEILIRPLIVCKLKY-GNGVFNED-ICAGRMG-KGGCYGDSG 202

  Fly   209 GPLVYRGQVCGIVS--WGFGCARPSFPGVYTNVASER 243
            ||||:.||:.||.|  ....|...|   :|.:||..|
  Fly   203 GPLVFNGQLVGITSRTGNIVCLGSS---LYASVARYR 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 72/218 (33%)
Tryp_SPc 26..251 CDD:238113 73/221 (33%)
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 74/222 (33%)
Tryp_SPc 30..239 CDD:238113 73/221 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.