DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and Ser12

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster


Alignment Length:249 Identity:91/249 - (36%)
Similarity:133/249 - (53%) Gaps:10/249 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLWWLCHLALV--LPSSSSKTRIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAHCV 68
            ||.||..:|.|  :.:.||..|||||....|||||:...|..:..:|||..:.|.:.:::|||||
  Fly     2 LLHWLVLVASVTLISAGSSPERIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHCV 66

  Fly    69 YGSQPEGFTVHAGASRLDQEAPVVRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTPGKVATIS 133
            .......::|..|:...:......|..|:.......|:|....|:|:::|.:.::.. .:|..|.
  Fly    67 ERPFDTLYSVRVGSVWKNLGGQHARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIFN-AEVRPIQ 130

  Fly   134 PCRNPPEGNAYARISGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGYGQLSDSMLCAAVRG 198
            ...:.|.....|.:||||.......:|...::|: |::|....||.||.   .::.:|:|||.. 
  Fly   131 LADSAPAAGTEASVSGWGEIGILWLQPTSLLKTS-VKILDPNVCKRSYQ---YITKTMICAAAL- 190

  Fly   199 LRDSCSGDSGGPLVYRGQVCGIVSWGFGCARPSFPGVYTNVASER--VHEFIEQ 250
            |:|||.||||||||..||:.||||:|.|||.|.|||||.|||..:  :...|||
  Fly   191 LKDSCHGDSGGPLVSGGQLVGIVSYGIGCANPFFPGVYANVAELKPWILNAIEQ 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 79/215 (37%)
Tryp_SPc 26..251 CDD:238113 82/227 (36%)
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 80/220 (36%)
Tryp_SPc 24..238 CDD:238113 79/219 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D114140at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.