DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and CG1304

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster


Alignment Length:249 Identity:76/249 - (30%)
Similarity:112/249 - (44%) Gaps:39/249 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LALVLPSSSS----KTRIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAHCVYGSQP 73
            |.|.:|..|:    ..|:|||::...::.|:.|.||..|...||||::|...||:|||||.....
  Fly    15 LLLAVPVHSAPGSLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAHCVTNQDS 79

  Fly    74 EG---------FTVHAGASR------LDQEAPVVRNVVMFHTSPSYSATNFDMDVALLQLQEVVV 123
            .|         ||:.||::.      |.|.|.|:       ....|.  ||..|||||:|:..::
  Fly    80 NGNSVPIAAERFTIRAGSNDRFSGGVLVQVAEVI-------VHEEYG--NFLNDVALLRLESPLI 135

  Fly   124 LTPGKVATISPCRNP---PEGNAYARISGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGYG 185
            |:    |:|.|...|   ...:....|||||..:.....| ..::...::.:....|. ...|:|
  Fly   136 LS----ASIQPIDLPTADTPADVDVIISGWGRIKHQGDLP-RYLQYNTLKSISLERCD-ELIGWG 194

  Fly   186 QLSDSMLCAAVRGLRDSCSGDSGGPLVYRGQVCGIVSWGFGCARPSFPGVYTNV 239
            ..|:  ||........:|:||||||.||..||.|:..:.:.....|:|..|..|
  Fly   195 VQSE--LCLIHEADNGACNGDSGGPAVYNNQVVGVAGFVWSACGTSYPDGYARV 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 72/233 (31%)
Tryp_SPc 26..251 CDD:238113 71/232 (31%)
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 72/233 (31%)
Tryp_SPc 32..256 CDD:238113 71/232 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.