DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and Ser6

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster


Alignment Length:259 Identity:79/259 - (30%)
Similarity:119/259 - (45%) Gaps:51/259 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LCH--LALVLPSSSS----KTRIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAHCV 68
            ||.  |.||||..|:    ..|:|||::...::.|:.|.||..|...||||:::...:|:|||||
  Fly    10 LCSFLLFLVLPVQSAPGKLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAHCV 74

  Fly    69 YGSQ---------PEGFTVHAGASR------LDQEAPVVRNVVMFHTSPSYSATNFDMDVALLQL 118
            ....         .|.||:.||::.      |.|.|.|:       ....|.  ||..|||||:|
  Fly    75 SNEDVNHVITPIAAERFTIRAGSNDRFSGGVLVQVAEVI-------VHEEYG--NFLNDVALLRL 130

  Fly   119 QEVVVLTPGKVATISPCRNP---PEGNAYARISGWGVTRENNREPAEQVRTTMVRVLPGAECK-- 178
            :..::|:    |:|.|...|   ...:....|||||..:.....| ..::...::.:...:|:  
  Fly   131 ESPLILS----ASIQPIDLPTVDTPADVDVVISGWGRIKHQGDLP-RYLQYNTLKSITRQQCEEL 190

  Fly   179 ISYSGYGQLSDSMLCAAVRGLRDSCSGDSGGPLVYRGQVCGIVSWGF---GCARPSFPGVYTNV 239
            |.:...|:     ||...:....:|:||||||.||..|:.|:.  ||   ||. .::|..|..|
  Fly   191 IDFGFEGE-----LCLLHQVDNGACNGDSGGPAVYNNQLVGVA--GFVVDGCG-STYPDGYARV 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 71/238 (30%)
Tryp_SPc 26..251 CDD:238113 70/237 (30%)
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 71/238 (30%)
Tryp_SPc 32..256 CDD:238113 70/237 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.