DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and CG9672

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster


Alignment Length:238 Identity:63/238 - (26%)
Similarity:109/238 - (45%) Gaps:16/238 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAHCVYGSQPEG------FTVHAGAS 83
            ||.||::..:.::||...|...|.:.||..:|..|..|:|..||.....:.      |.|..|:.
  Fly    24 RIAGGEDAVLGQLPYQAALSIGGSYNCGAVIIGQRYALTALSCVCSDGKDTPWAAVLFAVTVGSV 88

  Fly    84 RLDQEAPV-VRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTPGKVATISPCRNPPEGNAYARI 147
            .|.....: |..:.:   :|:||  .....:|||:|||.:..:. .|..|...::.|...:...:
  Fly    89 DLYNGKQIRVEEITI---NPNYS--TLKTGIALLRLQEEITFSE-TVNAIPLSQDVPPMGSQVEV 147

  Fly   148 SGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGYGQLSDSMLCAAVRGLRDS-CSGDSGGPL 211
            ||||.|.|:.......::.....|:...||.::......::|..:.....|.|.. ||||.|||.
  Fly   148 SGWGRTTESEVNMHRTLQIGAAEVMAPRECALANRDELLVADDQVLCLGHGRRQGICSGDIGGPA 212

  Fly   212 VYRGQVCGIVSWGFGCARPSFPGVYTNVASERVHEFIEQTLRR 254
            ||:||:.|:.:...|......|..:.::|:.  :::|:|.|::
  Fly   213 VYQGQLVGLGAQILGECGGMLPERFISIAAN--YDWIQQQLQQ 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 59/223 (26%)
Tryp_SPc 26..251 CDD:238113 60/232 (26%)
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 60/230 (26%)
Tryp_SPc 25..250 CDD:238113 60/232 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.