DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and CG9676

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster


Alignment Length:258 Identity:81/258 - (31%)
Similarity:123/258 - (47%) Gaps:37/258 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLWWLCHLAL----VLPSSSS--KTRIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSA 64
            |.:|...|.|    ||..:.|  :.|||||.:....:.|:.:.||:.|...||||:||...|::|
  Fly     2 LPFWTSLLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTA 66

  Fly    65 AHCVYGSQPEGFTVHAGASRLDQEA------------PVVRNVVMFHTSPSYSATNFDMDVALLQ 117
            ||||    .:|..| |.|:.|:.:|            ||.  .|..|  |:|::...  |||:|:
  Fly    67 AHCV----KQGNNV-APANELEIQAGSLLLSSGGVRVPVA--TVTVH--PNYNSNGH--DVAVLR 120

  Fly   118 LQEVVVLTPGKVATISPCRNPPEGNAYARISGWGVTRENNREP-AEQVRTTMVRVLPGAECKISY 181
            |:..:... ..:|.|......|..:|...|||||..  :.|.| :..:....|:.|....|:.:|
  Fly   121 LRNSLTFN-SNIAAIKLATEDPPNDATVDISGWGAI--SQRGPISNSLLYVQVKALSRESCQKTY 182

  Fly   182 SGYGQLSDSMLCAAVRGLRDSCSGDSGGPLVYRGQVCGIVSWGF-GCARPSFPGVYTNVASER 243
              ..||.::.:|......:.:|.||||||..|:|::.|:.|:.. ||.|.: |..|..|:..|
  Fly   183 --LRQLPETTMCLLHPKDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAA-PDGYERVSKLR 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 73/229 (32%)
Tryp_SPc 26..251 CDD:238113 73/232 (31%)
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 74/233 (32%)
Tryp_SPc 28..248 CDD:238113 73/232 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.