DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and prss59.1

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_955899.2 Gene:prss59.1 / 322453 ZFINID:ZDB-GENE-030131-1173 Length:242 Species:Danio rerio


Alignment Length:243 Identity:85/243 - (34%)
Similarity:127/243 - (52%) Gaps:36/243 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAHCVYGSQPE------GFTVHAGAS 83
            :||||.|...:..|:...| .:||..|||||:|...|:||||| |.|:.|      ...::.|..
Zfish    20 KIVGGYECQPNSQPWQASL-NSGYHFCGGSLVSEYWVVSAAHC-YKSRVEVRLGEHNIVINEGTE 82

  Fly    84 RLDQEAPVVRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTPGKVATISPCRNP---PEGNA-- 143
            :......|:||       |:|.:.:.|.|:.|::|        .|.||::....|   |.|.|  
Zfish    83 QFITSEKVIRN-------PNYDSWDLDSDIMLIKL--------SKPATLNKYVQPVALPNGCAAD 132

  Fly   144 --YARISGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGYGQLSDSMLCAA-VRGLRDSCSG 205
              ..|:||||.|..:..: :.:::...:.:|...:|..||.  |.::|:|.||. :.|.:|||.|
Zfish   133 GTMCRVSGWGNTMSSTAD-SNKLQCLEIPILSDRDCNNSYP--GMITDTMFCAGYLEGGKDSCQG 194

  Fly   206 DSGGPLVYRGQVCGIVSWGFGCARPSFPGVYTNVASERVHEFIEQTLR 253
            |||||:|..|::.||||||:|||..:.||||..|.  ...::|..|:|
Zfish   195 DSGGPVVCNGELHGIVSWGYGCAEKNHPGVYGKVC--MFSQWIADTMR 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 82/229 (36%)
Tryp_SPc 26..251 CDD:238113 83/238 (35%)
prss59.1NP_955899.2 Tryp_SPc 20..235 CDD:214473 82/236 (35%)
Tryp_SPc 21..238 CDD:238113 83/238 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.