DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and CG32834

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001188996.1 Gene:CG32834 / 318238 FlyBaseID:FBgn0052834 Length:556 Species:Drosophila melanogaster


Alignment Length:279 Identity:77/279 - (27%)
Similarity:117/279 - (41%) Gaps:79/279 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLW--WLCHLALVL----PSSSSKTRIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSA 64
            ::|  :|..||.:|    ....:::||:||.:..|.:.||...:..:|..||.|::|:|..:::|
  Fly     1 MIWSVFLFLLAALLRPVRGDLDAQSRIIGGYDVDIEDAPYQAEVIIDGTAICSGAIITSDTIITA 65

  Fly    65 AHCV--YGSQPEGFTVHAGASRLDQEAP-VVRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTP 126
            |.||  |||    ..|..|.|..|.:.. .:..|......|.|:...||.::|||:|.: .:.|.
  Fly    66 ASCVQSYGS----IEVRVGTSSRDYDGTGFLLEVCEIINHPQYNCWRFDNNLALLKLCD-PLKTS 125

  Fly   127 GKVATISPCRNPPEGNAYARISGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSG------YG 185
            ..:..||...:.|:..::..:||||.|                          |:.|      :|
  Fly   126 EAIQPISIAEDEPDDGSWCTVSGWGST--------------------------SWWGSWWDRCFG 164

  Fly   186 QLSDSM-----------LCAAVRGL-------------------RDSCSGDSGGPLVYRGQVCGI 220
            .|.|.:           .|||.||:                   ...||.|:|.|||..||:.||
  Fly   165 SLPDYLQMAWVSVYNREQCAADRGVWFGLWDNGISYLTLCTHNGAGGCSYDTGAPLVIDGQLVGI 229

  Fly   221 VSWGFGCARPSFPGVYTNV 239
            :|.| ||.  :.|.||.||
  Fly   230 LSEG-GCT--TKPDVYANV 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 72/254 (28%)
Tryp_SPc 26..251 CDD:238113 71/253 (28%)
CG32834NP_001188996.1 Tryp_SPc 26..252 CDD:214473 72/254 (28%)
Tryp_SPc 27..255 CDD:238113 71/253 (28%)
BES1_N <293..343 CDD:283367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.