DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and CG32755

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster


Alignment Length:273 Identity:92/273 - (33%)
Similarity:136/273 - (49%) Gaps:53/273 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 WLCHLALVLPSSSSKT----------------RIVGGKETTISEVPYLVYLRQNGY--------F 49
            |:|.|.:...|..:::                :||||...||.:||:.|.:|:...        .
  Fly     5 WMCLLIVATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGH 69

  Fly    50 ICGGSLISSRAVLSAAHC---------VYGSQPEGFTVHAGASRLD------QEAPVVRNVVMFH 99
            :|||::||.|.|.|||||         || ..||.:.|.||:|.:|      ||..|.|  ::.|
  Fly    70 VCGGAVISQRVVCSAAHCYAINTSVPLVY-RDPELYVVVAGSSAIDRTDRFTQEYLVQR--IVGH 131

  Fly   100 TSPSYSATNFDMDVALLQLQEVVVL-TPGKVATISPCRNPPEGNAYARISGWGVTRENNREPAEQ 163
              ..|:.:..:.|:|||.|...:.. :||..|.....:.|.||.. ..|.|||  :...:|.:..
  Fly   132 --KDYNGSTLENDIALLFLNGFIPWESPGVRAIPLAIKAPEEGTT-CLIHGWG--KVTMKEKSAS 191

  Fly   164 VRTTMVRVLPGAECKISYSGYGQLSDSMLCAA-VRGLRDSCSGDSGGPLVYRGQVCGIVSWGFGC 227
            ::...|.:|....|::.|    :|..|.:||. ::|..|:|.|||||||:..|::.||:|||.||
  Fly   192 LQQAPVPILNKELCQVIY----KLPASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISWGVGC 252

  Fly   228 ARPSFPGVYTNVA 240
            |.|.:|||||||:
  Fly   253 ADPGYPGVYTNVS 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 88/241 (37%)
Tryp_SPc 26..251 CDD:238113 88/240 (37%)
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 88/241 (37%)
Tryp_SPc 38..273 CDD:238113 88/240 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455646
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.