DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and CG32523

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster


Alignment Length:255 Identity:77/255 - (30%)
Similarity:120/255 - (47%) Gaps:27/255 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLWWLCHLALVL--------PSSSSKTRIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVL 62
            ||..||.:.::|        ..|:.:.|||||.:....:.|:.:.||..|...|||.:||:..|:
  Fly     9 LLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVI 73

  Fly    63 SAAHCV-YGSQ---PEGFTVHAGASRLDQEA---PVVRNVVMFHTSPSYSATNFDMDVALLQLQE 120
            :|.||| :|:.   .:.:::.||:..|..:.   ||..  |:.|  |:| ||....|:|:|:||.
  Fly    74 TAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAE--VIMH--PNY-ATGGHNDLAVLRLQS 133

  Fly   121 VVVLTPGKVATISPCRNPPEGNAYARISGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGYG 185
            .:.. ...:|.|......|.......|||||...|........:...:..:..|| |:..:  |.
  Fly   134 PLTF-DANIAAIQLATEDPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGA-CRWMF--YS 194

  Fly   186 QLSDSMLCAAVRGLRDSCSGDSGGPLVYRGQVCGIVS--WGFGCARPSFPGVYTNVASER 243
            :|.::|:|........:|.||||||..|.|:|.|:.|  .|.||.|.: |..|..::..|
  Fly   195 RLPETMICLLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCGRAA-PDGYLRISKVR 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 70/224 (31%)
Tryp_SPc 26..251 CDD:238113 70/227 (31%)
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 71/228 (31%)
Tryp_SPc 37..219 CDD:238113 56/190 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.