DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and CG32376

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:239 Identity:79/239 - (33%)
Similarity:128/239 - (53%) Gaps:14/239 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SSKTRIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAHCVYGSQPEGFTVHAGASRL 85
            |..||||.||....:|.|:...|...|||:||..:|:...:|:|.||.:| .||.:||..|:.: 
  Fly    61 SFPTRIVNGKRIPCTEAPFQGSLHYEGYFVCGCVIINKIWILTAHHCFFG-PPEKYTVRVGSDQ- 123

  Fly    86 DQEAPVVRNVVMFHTSPSYSATNFDMDVALLQLQEVV----VLTPGKVATISPCRNPPEGNAYAR 146
            .:....:|:|.......:|:......|:|:::|:..|    .:.|.|:.:....:.|.:    ..
  Fly   124 QRRGGQLRHVKKIVALAAYNDYTMRHDLAMMKLKSPVYFGKCVRPVKLPSTKTTKFPKK----FV 184

  Fly   147 ISGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGYG-QLSDSMLCAAVRGLRDSCSGDSGGP 210
            :||||:|..|.:.....:|...:..:..::|:..|...| ::...|:||: |..:||||||||||
  Fly   185 VSGWGITSANAQNVQRYLRRVQIDYIKRSKCQKMYKKAGLKIYKDMICAS-RTNKDSCSGDSGGP 248

  Fly   211 LVYRGQVCGIVSWGFGCARPSFPGVYTNVASERVHEFIEQTLRR 254
            |..||.:.||||||.|||..::||||.|  .:|...:|::.:.:
  Fly   249 LTSRGVLYGIVSWGIGCANKNYPGVYVN--CKRYVPWIKKVIHK 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 75/220 (34%)
Tryp_SPc 26..251 CDD:238113 76/229 (33%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 76/227 (33%)
Tryp_SPc 66..287 CDD:238113 76/229 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.