DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and CG14780

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster


Alignment Length:271 Identity:88/271 - (32%)
Similarity:138/271 - (50%) Gaps:39/271 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLWWLCHLALVLPSSSSKTRIVGGKETTISEVPYLVYLR----QNGY---FICGGSLISSRAVLS 63
            |.|:|...|......:.::||:.|......|..:||.:|    .|.:   .||||:||:.|.||:
  Fly    13 LFWFLLACAAADLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKVLT 77

  Fly    64 AAHCVYGSQPEGF-----------TVHAGASRLDQEAPVVRNVVMFHTSPSYSATNFDMDVALLQ 117
            ||||:|.:|.:.|           |::....|.......|.::...||   :|..:...||.:|.
  Fly    78 AAHCLYNNQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHT---FSPDSMRDDVGILF 139

  Fly   118 LQEVVVLTPGKVA--TISPCR-----NPPEGNAYARISGWGVTRENNREPAEQVRTTMVRVLPGA 175
            |:..:.::||...  |::|.:     .||  ....:::|||.|.:::.  :..:.|..|..:...
  Fly   140 LRTGLPMSPGGGVHLTVAPIQLAGQITPP--GKLCQVAGWGRTEQSSL--SNILLTANVSTIRHQ 200

  Fly   176 ECKISY-SGYGQLSDSMLCAA-VRGLRDSCSGDSGGPLVYRGQVCGIVSWGFGCARPSFPGVYTN 238
            .|::.| ||   |...|:||. ::|..|||.||||||||:.|::.|:||||:|||.|..||||.:
  Fly   201 TCRMIYRSG---LLPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLPGVYVD 262

  Fly   239 VASERVHEFIE 249
            |  |...::||
  Fly   263 V--EYYRQWIE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 81/242 (33%)
Tryp_SPc 26..251 CDD:238113 83/251 (33%)
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 82/249 (33%)
Tryp_SPc 33..271 CDD:238113 81/249 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.