DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and Elane

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001100237.1 Gene:Elane / 299606 RGDID:1307968 Length:271 Species:Rattus norvegicus


Alignment Length:242 Identity:71/242 - (29%)
Similarity:104/242 - (42%) Gaps:31/242 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LCHLALVLPSSSSKTRIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAHCVYGSQPE 74
            |..|.||.|:.:|:  ||||:.......|::|.|::.|...||.:||:...|:||||||.|...:
  Rat    19 LLALLLVCPALASE--IVGGRPAQPHAWPFMVSLQRRGGHFCGATLIARNFVMSAAHCVNGRNFQ 81

  Fly    75 GFTVHAGASRLDQEAPV-----VRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTPGKVATISP 134
            ...|..||..|.:..|.     |:.:......||....    |:.::||.....:.........|
  Rat    82 SVQVVLGAHDLRRREPTRQIFSVQRIFENGFDPSRLLN----DIVIIQLNGSATINANVQVAELP 142

  Fly   135 CRNPPEGNAYARIS-GWGVTRENNREPA--EQVRTTMVRVLPGAECKISYSGYGQLSDSMLCAAV 196
            .:....||....:: |||....|...|:  :::..|:|..|    |:...:         :|..|
  Rat   143 AQGQGVGNRTPCVAMGWGRLGTNRPLPSVLQELNVTVVTNL----CRRRVN---------VCTLV 194

  Fly   197 -RGLRDSCSGDSGGPLVYRGQVCGIVSW--GFGCARPSFPGVYTNVA 240
             |.....|.||||||||....|.||.|:  | ||....:|..:..||
  Rat   195 PRRQAGICFGDSGGPLVCNNLVQGIDSFIRG-GCGSGFYPDAFAPVA 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 65/227 (29%)
Tryp_SPc 26..251 CDD:238113 65/226 (29%)
ElaneNP_001100237.1 Tryp_SPc 32..246 CDD:214473 65/229 (28%)
Tryp_SPc 33..249 CDD:238113 65/226 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.