DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and Klk1c3

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001258244.1 Gene:Klk1c3 / 292872 RGDID:735032 Length:255 Species:Rattus norvegicus


Alignment Length:271 Identity:77/271 - (28%)
Similarity:129/271 - (47%) Gaps:41/271 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LWWL-CHLALVL----PSSSSKTRIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAH 66
            :|:| ..|||.|    .:...::|:|||.:...:..|:.|.:....  :|||.||....|::|||
  Rat     1 MWFLILFLALSLGQIDAAPPGQSRVVGGFKCEKNSQPWQVAVINED--LCGGVLIDPSWVITAAH 63

  Fly    67 CVYGSQPEGFTVHAGASRLDQEAP----------------VVRNVVMFHTSPSYSATNFDMDVAL 115
            |    ..:.:.|..|.:.|.::..                ::||    ||......:|   |:.|
  Rat    64 C----YSDNYHVLLGQNNLSEDVQHRLVSQSFRHPDYKPFLMRN----HTRKPKDYSN---DLML 117

  Fly   116 LQLQEVVVLTPGKVATISPCRNPPEGNAYARISGWGVTRENNREPAEQVRTTMVRVLPGAECKIS 180
            |.|.|...:|.|......|.:.|..|:. ..:||||.|..:..|..:.::...:.:|...:|..:
  Rat   118 LHLSEPADITDGVKVIDLPTKEPKVGST-CLVSGWGSTNPSEWEFPDDLQCVNIHLLSNEKCIKA 181

  Fly   181 YSGYGQLSDSMLCAA-VRGLRDSCSGDSGGPLVYRGQVCGIVSWG-FGCARPSFPGVYTNVASER 243
            |.  .:::|.||||. :.|.:|:|.|||||||:..|.:.||.||| ..|..|:.||:||.:.  :
  Rat   182 YK--EKVTDLMLCAGELEGGKDTCRGDSGGPLICDGVLQGITSWGSVPCGEPNKPGIYTKLI--K 242

  Fly   244 VHEFIEQTLRR 254
            ...:|::.:::
  Rat   243 FTSWIKEVMKK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 70/233 (30%)
Tryp_SPc 26..251 CDD:238113 70/242 (29%)
Klk1c3NP_001258244.1 Tryp_SPc 24..247 CDD:214473 70/240 (29%)
Tryp_SPc 25..250 CDD:238113 70/242 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.