DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and Klk10

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001004100.1 Gene:Klk10 / 292850 RGDID:1303242 Length:279 Species:Rattus norvegicus


Alignment Length:254 Identity:73/254 - (28%)
Similarity:119/254 - (46%) Gaps:27/254 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LRLLWWLCHLALVLPSSSSKTRI--VGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAH 66
            |.:..|... ||:||.::::..:  .|....::|: |:.|.|..|..|.|.|.|:....||:|||
  Rat    25 LMMQLWAAQ-ALLLPGNTTREDLEAFGTLCPSVSQ-PWQVSLFHNLQFQCAGVLVDQNWVLTAAH 87

  Fly    67 CVYGSQPEGFTVHAGASRL---DQEAPVVRNVVMFH------TSPSYSATNFDMDVALLQLQEVV 122
            | :.::|  .....|...|   ..|.....|..:||      :.|.....:.:.|:.:|:|...|
  Rat    88 C-WRNKP--LRARVGDDHLLLFQSEQLRSTNSPVFHPKYQPCSGPVLPLRSDEHDLMMLKLSSPV 149

  Fly   123 VLTPGKVATIS---PCRNPPEGNAYARISGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGY 184
            ||| .||..:.   .|..|.:   ..::||||.|.....:....:..:.|.:|...:|:..|.|.
  Rat   150 VLT-SKVHPVQLPFQCAQPRQ---ECQVSGWGTTANRRVKYNRSLSCSRVTLLSQKQCETFYPGV 210

  Fly   185 GQLSDSMLCAAVRGLRDSCSGDSGGPLVYRGQVCGIVSWG-FGC-ARPSFPGVYTNVAS 241
              ::::|:||.:...:|||..|||||||....:.||:||. :.| |...:|.||..:.:
  Rat   211 --ITNNMICAGMDRDQDSCQSDSGGPLVCDNTLHGILSWSIYPCGAATQYPAVYAKICN 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 67/231 (29%)
Tryp_SPc 26..251 CDD:238113 67/232 (29%)
Klk10NP_001004100.1 Tryp_SPc 50..272 CDD:214473 67/228 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.