DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and Klk11

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001099722.1 Gene:Klk11 / 292849 RGDID:1308690 Length:279 Species:Rattus norvegicus


Alignment Length:252 Identity:83/252 - (32%)
Similarity:123/252 - (48%) Gaps:23/252 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LALVLPSSSSKTRIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAHCVYGSQPEGFT 77
            ||||......:|||:.|.|......|:.|.|.|....:||.:||:.:.:|:||||   .:|. :.
  Rat    38 LALVTGHVGGETRIIKGYECRPHSQPWQVALFQKTRLLCGATLIAPKWLLTAAHC---RKPH-YV 98

  Fly    78 VHAGASRLDQ----EAPVVRNVVMFHTSPSYSATNFD--MDVALLQLQEVVVLTPG-KVATISP- 134
            :..|...|::    |...:......|...:.|..|.|  .|:.|:::.....:|.. :..|:|. 
  Rat    99 ILLGEHNLEKTDGCEQRRMATESFPHPGFNNSLPNKDHRNDIMLVKMSSPAFITRAVRPLTLSSL 163

  Fly   135 CRNPPEGNAYARISGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGYGQLSDSMLCAAVR-- 197
            |   ........|||||.|..........:|...|.::...||:.:|.  |.::|:||||:||  
  Rat   164 C---VTAGTSCLISGWGTTSSPQLRLPHSLRCANVSIIGHKECERAYP--GNITDTMLCASVRKE 223

  Fly   198 GLRDSCSGDSGGPLVYRGQVCGIVSWGFG-CARPSFPGVYTNVASERVHEFIEQTLR 253
            | :|||.||||||||..|.:.||:|||.. ||....|||||.|.  :..::|.:.:|
  Rat   224 G-KDSCQGDSGGPLVCNGSLQGIISWGQDPCAVTRKPGVYTKVC--KYFDWIHEVMR 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 76/226 (34%)
Tryp_SPc 26..251 CDD:238113 76/235 (32%)
Klk11NP_001099722.1 Tryp_SPc 50..272 CDD:214473 76/233 (33%)
Tryp_SPc 51..275 CDD:238113 76/235 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.