DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and Prss38

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:XP_006246600.1 Gene:Prss38 / 287358 RGDID:1565729 Length:380 Species:Rattus norvegicus


Alignment Length:259 Identity:76/259 - (29%)
Similarity:128/259 - (49%) Gaps:34/259 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLWWLC----HLALVLPSSSSKT----RIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVL 62
            |||  |    .|.|.|.|:..:.    :::||:.|...:.|:.|.:...|:.:||||::::..||
  Rat    88 LLW--CGREPSLHLFLSSACGQPALHGKLLGGELTIDRKWPWQVSIHYAGFHVCGGSILNAYWVL 150

  Fly    63 SAAHC-VYGSQPEGFTVHAGASRLDQEAPVVR----NVVMFHTSPSYSATNFDM------DVALL 116
            :|||| ....:.:.|.::.|.:.|:......:    |.|:.|.:       |:|      ||||:
  Rat   151 TAAHCFAREKRLQTFDMYVGITNLEVANKHTQWFEINQVIIHPT-------FEMFHPVGGDVALV 208

  Fly   117 QLQEVVVLTPGKVATISPCRNPPEGNAYARISGWGVTRENNREPAEQVRTTMVRVLPGAECKISY 181
            |.:..:|.:...:....|..|....:.....:|||:..... |..:.:....:.::|..:|::.|
  Rat   209 QSKSAIVFSDYVLPICLPSSNLNLSDLSCWTTGWGMVSPQG-ETGKDLLEAQLPLIPKFQCQLLY 272

  Fly   182 SGYGQLSDSMLCAA-VRGLRDSCSGDSGGPLVYR-GQV---CGIVSWGFGCARPSFPGVYTNVA 240
            .....|...||||. ::.:::.|.||||.|||.: .|.   .||||||.|||:|.:|||:.||:
  Rat   273 GLTSYLLPEMLCAGDIKNMKNVCEGDSGSPLVCKVNQTWLQIGIVSWGRGCAQPLYPGVFANVS 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 68/232 (29%)
Tryp_SPc 26..251 CDD:238113 68/231 (29%)
Prss38XP_006246600.1 Tryp_SPc 116..343 CDD:238113 68/229 (30%)
Tryp_SPc 116..342 CDD:214473 68/229 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.