DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and Prss29

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:XP_017453326.1 Gene:Prss29 / 287136 RGDID:1305856 Length:279 Species:Rattus norvegicus


Alignment Length:266 Identity:90/266 - (33%)
Similarity:129/266 - (48%) Gaps:34/266 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VGLRLLWWLCHLALVLPSSSSK---TRIVGGKETTISEVPYLVYLRQNGY------FICGGSLIS 57
            :||.|::....:| .:|:|..:   ..||||......:.|:.|.||...|      .|||||:|.
  Rat     5 LGLTLIFLGSSIA-GIPASVPEDVLVGIVGGNSAPQGKWPWQVSLRVYRYNWASWVHICGGSIIH 68

  Fly    58 SRAVLSAAHCVYGS--QPEGFTVHAGASRL---DQEAPVVRNVVMFHTSPSYSATNFDMDVALLQ 117
            .:.||:||||::.|  .|..|.::.|...|   ::...|.|  |:.|  |.:..:....||||||
  Rat    69 PQWVLTAAHCIHESDADPSAFRIYLGQVYLYGGEKLLKVSR--VIIH--PDFVRSGLGSDVALLQ 129

  Fly   118 LQEVVVLTPG-KVATISPCRNPPEGNAYARISGWG-VTRENNREPAEQVRTTMVRVLPGAECKIS 180
            |.:.|...|. |...:||............::||| |:...:..|..:::...|:::....|:..
  Rat   130 LAQSVRSFPNVKPVKLSPASLEVTKKDVCWVTGWGSVSMHESLPPPYRLQQVQVKIVDNTLCEKL 194

  Fly   181 Y------SGYGQ--LSDSMLCAAVRGLRDSCSGDSGGPLVYR----GQVCGIVSWGFGCARPSFP 233
            |      |.:||  :...||||...| ||||.||||||||..    ..:.|:||||:|||....|
  Rat   195 YRNATRLSNHGQRLILQDMLCAGSHG-RDSCYGDSGGPLVCNVTGSWTLVGVVSWGYGCALKDIP 258

  Fly   234 GVYTNV 239
            |||..|
  Rat   259 GVYARV 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 84/240 (35%)
Tryp_SPc 26..251 CDD:238113 84/239 (35%)
Prss29XP_017453326.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.