DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and LOC286960

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_775423.1 Gene:LOC286960 / 286960 RGDID:708585 Length:247 Species:Rattus norvegicus


Alignment Length:246 Identity:87/246 - (35%)
Similarity:125/246 - (50%) Gaps:21/246 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ALVLPSSSSKTRIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAHC------VYGSQ 72
            |:.||.:.. .:||||.......|||.|.|.......|||||||.:.|||||||      |...:
  Rat    13 AVALPVNDD-DKIVGGYTCPKHLVPYQVSLHDGISHQCGGSLISDQWVLSAAHCYKRKLQVRLGE 76

  Fly    73 PEGFTVHAGASRLDQEAPVVRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTPGKVATISPCRN 137
            .....:..|...:|.| .::|:       |.|:....|.|:.|::|:...||. .:|:|:|..|:
  Rat    77 HNIHVLEGGEQFIDAE-KIIRH-------PEYNKDTLDNDIMLIKLKSPAVLN-SQVSTVSLPRS 132

  Fly   138 PPEGNAYARISGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGYGQLSDSMLCAA-VRGLRD 201
            ....:|...:||||.|.....:....::.....||..:.||.||.  ||::.:|.|.. :.|.:|
  Rat   133 CASTDAQCLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKSYP--GQITSNMFCLGFLEGGKD 195

  Fly   202 SCSGDSGGPLVYRGQVCGIVSWGFGCARPSFPGVYTNVASERVHEFIEQTL 252
            ||.||||||:|..|::.||||||..||....|||||.|.:  ...:|::|:
  Rat   196 SCDGDSGGPVVCNGEIQGIVSWGSVCAMRGKPGVYTKVCN--YLSWIQETM 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 82/222 (37%)
Tryp_SPc 26..251 CDD:238113 83/231 (36%)
LOC286960NP_775423.1 Tryp_SPc 23..240 CDD:214473 82/229 (36%)
Tryp_SPc 24..243 CDD:238113 83/231 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.