DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and KLK9

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_036447.1 Gene:KLK9 / 284366 HGNCID:6370 Length:250 Species:Homo sapiens


Alignment Length:262 Identity:84/262 - (32%)
Similarity:119/262 - (45%) Gaps:40/262 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LCHLALVLPSSS-SKTRIVGGKETTISEVPYLVYLRQNGYF-----ICGGSLISSRAVLSAAHCV 68
            ||.|..:|.... :.||.:|.:|...:..|:     |.|.|     .||.:|||.|.:|:|||| 
Human     6 LCALLSLLAGHGWADTRAIGAEECRPNSQPW-----QAGLFHLTRLFCGATLISDRWLLTAAHC- 64

  Fly    69 YGSQPEGFTVHAGASRL-DQEAP-VVRNVVMFHTSPSY----SATNFDMDVALLQLQEVVVLTPG 127
               :.....|..|...| ..|.| .:..|..|...|.:    ||.:.:.|:.|::|.....|:| 
Human    65 ---RKPYLWVRLGEHHLWKWEGPEQLFRVTDFFPHPGFNKDLSANDHNDDIMLIRLPRQARLSP- 125

  Fly   128 KVATISP------CRNPPEGNAYARISGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGYGQ 186
               .:.|      |.:|   .....|||||............::...:.:|....|..:|.|:  
Human   126 ---AVQPLNLSQTCVSP---GMQCLISGWGAVSSPKALFPVTLQCANISILENKLCHWAYPGH-- 182

  Fly   187 LSDSMLCAAV-RGLRDSCSGDSGGPLVYRGQVCGIVSWGF-GCARPSFPGVYTNVAS--ERVHEF 247
            :|||||||.: .|.|.||.||||||||..|.:.|:||.|. .|:||..|.|||:|..  :.:.|.
Human   183 ISDSMLCAGLWEGGRGSCQGDSGGPLVCNGTLAGVVSGGAEPCSRPRRPAVYTSVCHYLDWIQEI 247

  Fly   248 IE 249
            :|
Human   248 ME 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 77/234 (33%)
Tryp_SPc 26..251 CDD:238113 78/245 (32%)
KLK9NP_036447.1 Tryp_SPc 24..247 CDD:238113 76/240 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.