DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and Prss2

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_036861.1 Gene:Prss2 / 25052 RGDID:3418 Length:246 Species:Rattus norvegicus


Alignment Length:236 Identity:86/236 - (36%)
Similarity:130/236 - (55%) Gaps:23/236 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAHCVYGSQ------PEGFTVHAGAS 83
            :||||.....:.|||.|.| .:||..||||||:.:.|:||||| |.|:      .....|..|..
  Rat    23 KIVGGYTCQENSVPYQVSL-NSGYHFCGGSLINDQWVVSAAHC-YKSRIQVRLGEHNINVLEGNE 85

  Fly    84 RLDQEAPVVRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTPGKVATIS-PCRNPPEGNAYARI 147
            :....|.::::       |::.....:.|:.|::|...|.|. .:|||:: |....|.| ....|
  Rat    86 QFVNAAKIIKH-------PNFDRKTLNNDIMLIKLSSPVKLN-ARVATVALPSSCAPAG-TQCLI 141

  Fly   148 SGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGYGQLSDSMLCAA-VRGLRDSCSGDSGGPL 211
            ||||.|..:.....:.::.....:||.|:|:.||.  |:::|:|:|.. :.|.:|||.||||||:
  Rat   142 SGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYP--GKITDNMVCVGFLEGGKDSCQGDSGGPV 204

  Fly   212 VYRGQVCGIVSWGFGCARPSFPGVYTNVASERVHEFIEQTL 252
            |..|::.||||||:|||.|..|||||.|.:  ..::|:.|:
  Rat   205 VCNGELQGIVSWGYGCALPDNPGVYTKVCN--YVDWIQDTI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 84/223 (38%)
Tryp_SPc 26..251 CDD:238113 85/232 (37%)
Prss2NP_036861.1 Tryp_SPc 23..239 CDD:214473 84/230 (37%)
Tryp_SPc 24..242 CDD:238113 85/232 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.