DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and CG30025

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_725036.1 Gene:CG30025 / 246398 FlyBaseID:FBgn0050025 Length:253 Species:Drosophila melanogaster


Alignment Length:220 Identity:79/220 - (35%)
Similarity:122/220 - (55%) Gaps:4/220 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAHCVYGSQPEGFTVHAGASRLDQEA 89
            |||||..||||..|:.:.|:::|...||||:.||..:::||||:.........:.||:|.. ...
  Fly    30 RIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYW-SSG 93

  Fly    90 PVVRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTPGKVATISPCRNPPEGNAYARISGWGVTR 154
            .|..:|..|.....|:|.....|:|::::...:..: ..:..|....:.|...|.|.:||||...
  Fly    94 GVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFS-STIKAIGLASSNPANGAAASVSGWGTLS 157

  Fly   155 ENNREPAEQVRTTMVRVLPGAECKISYSGYG-QLSDSMLCAAVRGLRDSCSGDSGGPLVYRGQVC 218
            ..:.....|::...|.::..::|..|..||| |:..:|:|||..| :|:|.||||||||..|.:.
  Fly   158 YGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAASG-KDACQGDSGGPLVSGGVLV 221

  Fly   219 GIVSWGFGCARPSFPGVYTNVASER 243
            |:||||:|||..::||||.:||:.|
  Fly   222 GVVSWGYGCAYSNYPGVYADVAALR 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 77/216 (36%)
Tryp_SPc 26..251 CDD:238113 78/219 (36%)
CG30025NP_725036.1 Tryp_SPc 30..249 CDD:214473 79/220 (36%)
Tryp_SPc 31..252 CDD:238113 78/219 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.