DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and Prss38

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001038986.1 Gene:Prss38 / 216797 MGIID:2685095 Length:322 Species:Mus musculus


Alignment Length:263 Identity:78/263 - (29%)
Similarity:128/263 - (48%) Gaps:40/263 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 WLCHLALVLPSSSSKT--------------RIVGGKETTISEVPYLVYLRQNGYFICGGSLISSR 59
            |:..::...|.|.:.:              :::||:.....:.|:.|.|..:|:.|||||::|:.
Mouse    25 WVTSVSRRHPKSQANSLSGDVACGQPVLQGKLLGGEFARDRKWPWQVSLHYSGFHICGGSILSAY 89

  Fly    60 AVLSAAHCV-YGSQPEGFTVHAGASRLDQEAPVVRNVVMFHTSPSYSATNFDM------DVALLQ 117
            .|||||||. .|.:.|.:.::.|.:.|::   ..|:...|..........|.|      ||||:|
Mouse    90 WVLSAAHCFDRGKKLETYDIYVGITNLEK---ANRHTQWFEIYQVIIHPTFQMYHPIGGDVALVQ 151

  Fly   118 LQEVVVLTPGKVATISPCRNPPEG----NAYARISGWGVTRENNREPAEQVRTTMVRVLPGAECK 178
            |:..:|.:.    .:.|...||..    |.....:|||:..... |...::....:.::|..:|:
Mouse   152 LKSAIVFSD----FVLPICLPPSDLYLINLSCWTTGWGMISPQG-ETGNELLEAQLPLIPRFQCQ 211

  Fly   179 ISYSGYGQLSDSMLCAA-VRGLRDSCSGDSGGPLVYRG-----QVCGIVSWGFGCARPSFPGVYT 237
            :.|.....|...||||| ::.:::.|.||||.|||.:.     |: ||||||.|||:|.:|||:.
Mouse   212 LLYGLSSYLLPEMLCAADIKTMKNVCEGDSGSPLVCKQNQTWLQI-GIVSWGRGCAQPLYPGVFA 275

  Fly   238 NVA 240
            ||:
Mouse   276 NVS 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 75/233 (32%)
Tryp_SPc 26..251 CDD:238113 75/232 (32%)
Prss38NP_001038986.1 Tryp_SPc 58..287 CDD:238113 75/230 (33%)
Tryp_SPc 58..284 CDD:214473 75/230 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.