DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and Prtn3

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_035308.2 Gene:Prtn3 / 19152 MGIID:893580 Length:254 Species:Mus musculus


Alignment Length:260 Identity:75/260 - (28%)
Similarity:112/260 - (43%) Gaps:45/260 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LALVLPSSSSKTRIVGGKETTISEVPYLVYL---RQNGYFICGGSLISSRAVLSAAHCVYGSQPE 74
            ||||:..:...::||||.|......||:..|   |..|...|||:||..|.||:||||:.....:
Mouse    17 LALVVGGAVQASKIVGGHEARPHSRPYVASLQLSRFPGSHFCGGTLIHPRFVLTAAHCLQDISWQ 81

  Fly    75 GFTVHAGA-----SRLDQEAPVVRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTPGKVATISP 134
            ..||..||     |..:|:...:..|...:.:|..:..    ||.||||.....|  ||...::.
Mouse    82 LVTVVLGAHDLLSSEPEQQKFTISQVFQNNYNPEENLN----DVLLLQLNRTASL--GKEVAVAS 140

  Fly   135 CRNPPEGNAYAR-----ISGWGVTRENNREPA----EQVRTTMVRVLPGAECKISYSGYGQLSDS 190
            .  |.:....::     ..|||  |...:.|.    :::..|:|..|    |:          :.
Mouse   141 L--PQQDQTLSQGTQCLAMGWG--RLGTQAPTPRVLQELNVTVVTFL----CR----------EH 187

  Fly   191 MLCAAV-RGLRDSCSGDSGGPLVYRGQVCGIVSWGF-GCARPSFPGVYTNVASERVHEFIEQTLR 253
            .:|..| |.....|.|||||||:..|.:.|:.|:.. .||...||..:..|:  ...::|:..||
Mouse   188 NVCTLVPRRAAGICFGDSGGPLICNGILHGVDSFVIRECASLQFPDFFARVS--MYVDWIQNVLR 250

  Fly   254  253
            Mouse   251  250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 68/234 (29%)
Tryp_SPc 26..251 CDD:238113 69/243 (28%)
Prtn3NP_035308.2 Tryp_SPc 29..245 CDD:214473 68/241 (28%)
Tryp_SPc 30..248 CDD:238113 69/243 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.