DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and try-1

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_494910.2 Gene:try-1 / 173856 WormBaseID:WBGene00006619 Length:293 Species:Caenorhabditis elegans


Alignment Length:244 Identity:85/244 - (34%)
Similarity:114/244 - (46%) Gaps:20/244 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RIVGGKETTISEVPYLVYLRQN-GYFICGGSLISSRAVLSAAHC-VYGSQPEGFTVHAGASRLDQ 87
            |::||.|::....|:.|.|... |:..||||||....||:|||| ....:|..::|..|..|...
 Worm    57 RLIGGSESSPHSWPWTVQLLSRLGHHRCGGSLIDPNFVLTAAHCFAKDRRPTSYSVRVGGHRSGS 121

  Fly    88 EAPVVRNVVMFHTSPSYSATNF--DMDVALLQLQEVVVLTPGKVATISP-C--RNPPEGNAYARI 147
            .:|.....|..|  |.|: ..|  ..|.|::::...|    ....|..| |  ..|...|....:
 Worm   122 GSPHRVTAVSIH--PWYN-IGFPSSYDFAIMRIHPPV----NTSTTARPICLPSLPAVENRLCVV 179

  Fly   148 SGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGYGQLS-DSMLCAAVR-GLRDSCSGDSGGP 210
            :|||.|.|.:...|..:|...|.:|....|....:..|::. .|||||... |..|||.||||||
 Worm   180 TGWGSTIEGSSLSAPTLREIHVPLLSTLFCSSLPNYIGRIHLPSMLCAGYSYGKIDSCQGDSGGP 244

  Fly   211 LVY----RGQVCGIVSWGFGCARPSFPGVYTNVASERVHEFIEQTLRRI 255
            |:.    ..::.|:||||.|||||..||||.||.|......:|....||
 Worm   245 LMCARDGHWELTGVVSWGIGCARPGMPGVYGNVHSASTWINLEMNRLRI 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 81/228 (36%)
Tryp_SPc 26..251 CDD:238113 82/237 (35%)
try-1NP_494910.2 Tryp_SPc 59..285 CDD:238113 81/232 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.