DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and Prss28

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_444489.2 Gene:Prss28 / 114661 MGIID:2149951 Length:274 Species:Mus musculus


Alignment Length:286 Identity:82/286 - (28%)
Similarity:126/286 - (44%) Gaps:49/286 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVGLRLLWWLC-----HLALVLPSSSSKTRIVGGKETTISEVPYLVYLRQNGY------FICGGS 54
            |..|.||...|     .:|.|..|.|....||||:.|...:.|:.|.||...|      .|||||
Mouse     1 MFRLLLLALSCLESTVFMASVSISRSKPVGIVGGQCTPPGKWPWQVSLRMYSYEVNSWVHICGGS 65

  Fly    55 LISSRAVLSAAHCVYG--SQPEGFTVHAGASRLDQEAPVVRNVVMFHTSPSYSATNFDMDVALLQ 117
            :|..:.:|:||||:..  :.|..:.|..|...|.:|..:: |:......|.|:..:...|:||:|
Mouse    66 IIHPQWILTAAHCIQSQDADPAVYRVQVGEVYLYKEQELL-NISRIIIHPDYNDVSKRFDLALMQ 129

  Fly   118 LQEVVVLTPGKVATISPCRNPPEGNAY-----ARISGWG-VTRENNREPAEQVRTTMVRVLPGAE 176
            |..::|.:    ..:||...|.:.:.:     ..:.||| :.:....:|..|:....:.:.....
Mouse   130 LTALLVTS----TNVSPVSLPKDSSTFDSTDQCWLVGWGNLLQRVPLQPPYQLHEVKIPIQDNKS 190

  Fly   177 CKISYSGYGQ-------LSDSMLCAAVRGLRDSCSGDSGGPLVYRGQVC---------GIVSWGF 225
            ||.:|.....       :.|.||||...| |..|.|||||||     ||         |:||.|.
Mouse   191 CKRAYRKKSSDEHKAVAIFDDMLCAGTSG-RGPCFGDSGGPL-----VCWKSNKWIQVGVVSKGI 249

  Fly   226 GCARPSFPGVYTNVASER--VHEFIE 249
            .|:. :.|.:::.|.|..  :|:.|:
Mouse   250 DCSN-NLPSIFSRVQSSLAWIHQHIQ 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 70/245 (29%)
Tryp_SPc 26..251 CDD:238113 73/256 (29%)
Prss28NP_444489.2 Tryp_SPc 31..272 CDD:238113 72/252 (29%)
Tryp_SPc 31..269 CDD:214473 71/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.