DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and Try5

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001003405.1 Gene:Try5 / 103964 MGIID:102756 Length:246 Species:Mus musculus


Alignment Length:236 Identity:83/236 - (35%)
Similarity:130/236 - (55%) Gaps:23/236 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAHCVYGSQ------PEGFTVHAGAS 83
            :||||.....:.:||.|.| .:||..||||||:.:.|:||||| |.::      .....|..|..
Mouse    23 KIVGGYTCRENSIPYQVSL-NSGYHFCGGSLINDQWVVSAAHC-YKTRIQVRLGEHNINVLEGNE 85

  Fly    84 RLDQEAPVVRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTPGKVATIS-PCRNPPEGNAYARI 147
            :....|.::::       |::::...:.|:.|::|...|.|. .:|||:: |....|.| ....|
Mouse    86 QFVNSAKIIKH-------PNFNSRTLNNDIMLIKLASPVTLN-ARVATVALPSSCAPAG-TQCLI 141

  Fly   148 SGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGYGQLSDSMLCAA-VRGLRDSCSGDSGGPL 211
            ||||.|........:.::.....:||.|:|:.||.  |:::::|:|.. :.|.:|||.||||||:
Mouse   142 SGWGNTLSFGVNNPDLLQCLDAPLLPQADCEASYP--GKITNNMICVGFLEGGKDSCQGDSGGPV 204

  Fly   212 VYRGQVCGIVSWGFGCARPSFPGVYTNVASERVHEFIEQTL 252
            |..||:.||||||:|||....|||||.|.:  ..::|:.|:
Mouse   205 VCNGQLQGIVSWGYGCALKDNPGVYTKVCN--YVDWIQDTI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 81/223 (36%)
Tryp_SPc 26..251 CDD:238113 82/232 (35%)
Try5NP_001003405.1 Tryp_SPc 23..239 CDD:214473 81/230 (35%)
Tryp_SPc 24..242 CDD:238113 82/232 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.