DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and Try5

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:XP_008761147.1 Gene:Try5 / 103690254 RGDID:1560283 Length:246 Species:Rattus norvegicus


Alignment Length:259 Identity:94/259 - (36%)
Similarity:141/259 - (54%) Gaps:26/259 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LRLLWWLCHL--ALVLPSSSSKTRIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAH 66
            :|.|.:|.|:  |:..|.... .:||||.....:.|||.|.| .:||..||||||:.:.|:||||
  Rat     1 MRALLFLAHVGAAVAFPIDDD-DKIVGGYTCQENSVPYQVSL-NSGYHFCGGSLINDQWVVSAAH 63

  Fly    67 CVYGSQ------PEGFTVHAGASRLDQEAPVVRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLT 125
            | |.|:      .....|..|..:....|.::::       |:::|.|.:.|:.|::|...|.|.
  Rat    64 C-YKSRIQVRLGEHNINVLEGNEQFVNAAKIIKH-------PNFNARNLNNDIMLIKLSVPVTLN 120

  Fly   126 PGKVATIS-PCRNPPEGNAYARISGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGYGQLSD 189
             .:|||:: |....|.| ....|||||.|........:.::.....|||.|:|:.||.  |::::
  Rat   121 -SRVATVALPSSCAPAG-TQCLISGWGNTLSLGVNNPDLLQCLDAPVLPQADCEASYP--GKITN 181

  Fly   190 SMLCAA-VRGLRDSCSGDSGGPLVYRGQVCGIVSWGFGCARPSFPGVYTNVASERVHEFIEQTL 252
            :|:|.. :.|.:|||.||||||:|..||:.||||||:|||....|||||.|.:  ..::|:.|:
  Rat   182 NMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALKDNPGVYTKVCN--YVDWIQDTI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 86/223 (39%)
Tryp_SPc 26..251 CDD:238113 87/232 (38%)
Try5XP_008761147.1 Tryp_SPc 23..239 CDD:214473 86/230 (37%)
Tryp_SPc 24..242 CDD:238113 87/232 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.