DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and Klk9

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_082936.2 Gene:Klk9 / 101533 MGIID:1921082 Length:251 Species:Mus musculus


Alignment Length:268 Identity:88/268 - (32%)
Similarity:131/268 - (48%) Gaps:35/268 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VGLRLLWWLCHLALVLPSSSSKTRIVGGKETTISEVPY---LVYLRQNGYFICGGSLISSRAVLS 63
            :||.|:.:    :|:.....:.||.||.:|...:..|:   |.||.:.   :||.:||:.:.:|:
Mouse     3 LGLTLVLF----SLLAGHCGADTRAVGARECVRNSQPWQAGLFYLTRQ---LCGATLINDQWLLT 60

  Fly    64 AAHCVYGSQPEGFTVHAGASRLDQ-EAP-VVRNVVMFHTSPSY----SATNFDMDVALLQLQEVV 122
            ||||    :.....|..|...|.: |.| .:..|..|...|.:    ||.:.:.|:.|::|...|
Mouse    61 AAHC----RKPYLWVRLGEHHLWRWEGPEQLLLVTDFFPHPGFNPDLSANDHNDDIMLIRLPRKV 121

  Fly   123 VLTPGKVATISPCR----NPPEGNAYARISGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSG 183
            .|||    .:.|..    .||.| ....|||||....:..:....::...:.:|....|:.:|.|
Mouse   122 RLTP----AVQPLNLTESRPPVG-TQCLISGWGSVSSSKLQYPMTLQCANISILDNKLCRWAYPG 181

  Fly   184 YGQLSDSMLCAAV-RGLRDSCSGDSGGPLVYRGQVCGIVSWGF-GCARPSFPGVYTNVASERVHE 246
            :  :|:.||||.: .|.|.||.||||||||..|.:.||||.|. .|:||..|.|||||..  ..|
Mouse   182 H--ISEKMLCAGLWEGGRGSCQGDSGGPLVCEGTLAGIVSGGSEPCSRPRRPAVYTNVFD--YLE 242

  Fly   247 FIEQTLRR 254
            :||.|:.:
Mouse   243 WIESTMEK 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 79/230 (34%)
Tryp_SPc 26..251 CDD:238113 81/239 (34%)
Klk9NP_082936.2 Tryp_SPc 24..247 CDD:238113 81/238 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.