DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BCL7-like and BCL7C

DIOPT Version :9

Sequence 1:NP_572562.1 Gene:BCL7-like / 31890 FlyBaseID:FBgn0026149 Length:154 Species:Drosophila melanogaster
Sequence 2:XP_011544282.1 Gene:BCL7C / 9274 HGNCID:1006 Length:293 Species:Homo sapiens


Alignment Length:116 Identity:50/116 - (43%)
Similarity:67/116 - (57%) Gaps:15/116 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RSVRAETRSRAKDDIKRVMQAVDKVRHWEKKWVTISDTTMKIYKWVPIASASEKKAKLESSPGSA 67
            |:||||||||||||||:||..::|||.|||:|||:.||:::|:||||:....|::.:........
Human     4 RTVRAETRSRAKDDIKKVMATIEKVRRWEKRWVTVGDTSLRIFKWVPVVDPQEEERRRAGGGAER 68

  Fly    68 AVRRPPPGSGVTPVGGS-----KSDKENS----------QKGTPTPPQITP 103
            :..|...|.|.:|.||.     ..:.|||          ||||...|..||
Human    69 SRGRERRGRGASPRGGGPLILLDLNDENSNQSFHSEGSLQKGTEPSPGGTP 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BCL7-likeNP_572562.1 BCL_N 2..49 CDD:282557 31/45 (69%)
BCL7CXP_011544282.1 BCL_N 4..50 CDD:282557 31/45 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159457
Domainoid 1 1.000 88 1.000 Domainoid score I7924
eggNOG 1 0.900 - - E1_KOG4095
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 94 1.000 Inparanoid score I5069
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1517597at2759
OrthoFinder 1 1.000 - - FOG0001798
OrthoInspector 1 1.000 - - otm41966
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12767
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2423
SonicParanoid 1 1.000 - - X1157
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.890

Return to query results.
Submit another query.