DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BCL7-like and Bcl7a

DIOPT Version :9

Sequence 1:NP_572562.1 Gene:BCL7-like / 31890 FlyBaseID:FBgn0026149 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_084126.1 Gene:Bcl7a / 77045 MGIID:1924295 Length:210 Species:Mus musculus


Alignment Length:161 Identity:62/161 - (38%)
Similarity:83/161 - (51%) Gaps:27/161 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RSVRAETRSRAKDDIKRVMQAVDKVRHWEKKWVTISDTTMKIYKWVPIA-------SASEKKAKL 60
            |||||||||||||||||||.|::|||.|||||||:.||:::||||||:.       :.::||.|.
Mouse     4 RSVRAETRSRAKDDIKRVMAAIEKVRKWEKKWVTVGDTSLRIYKWVPVTEPKVDDKNKNKKKGKD 68

  Fly    61 E------------SSPGSAAVRRPPPGSGVTPVG-GSKSDKENSQKGTPTPPQITPSYQGLTAED 112
            |            ||||...:.  ...|..:.:. .|...:|||...:|.|....|     ...|
Mouse    69 EKCGSEVTTPENSSSPGMMDMH--DDNSNQSSIADASPIKQENSSNSSPAPETNPP-----VPSD 126

  Fly   113 SNTCFSVVSDSQGADFVSSMPFSEDSNSQGS 143
            .....:..:.:.|.:...:...||:.|||.|
Mouse   127 GTEAKADEAQADGKEHPGAEDASEEQNSQSS 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BCL7-likeNP_572562.1 BCL_N 2..49 CDD:282557 36/45 (80%)
Bcl7aNP_084126.1 BCL_N 4..50 CDD:282557 36/45 (80%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..210 27/117 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 88 1.000 Domainoid score I7904
eggNOG 1 0.900 - - E1_KOG4095
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I5029
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1517597at2759
OrthoFinder 1 1.000 - - FOG0001798
OrthoInspector 1 1.000 - - otm44015
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12767
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2423
SonicParanoid 1 1.000 - - X1157
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.960

Return to query results.
Submit another query.