DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BCL7-like and bcl7a

DIOPT Version :9

Sequence 1:NP_572562.1 Gene:BCL7-like / 31890 FlyBaseID:FBgn0026149 Length:154 Species:Drosophila melanogaster
Sequence 2:XP_005165419.1 Gene:bcl7a / 57952 ZFINID:ZDB-GENE-000607-16 Length:202 Species:Danio rerio


Alignment Length:167 Identity:63/167 - (37%)
Similarity:85/167 - (50%) Gaps:29/167 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RSVRAETRSRAKDDIKRVMQAVDKVRHWEKKWVTISDTTMKIYKWVPIA-------SASEKKAKL 60
            |||||||||||||||||||.|::|||.|||||||:.||:::||||||:.       :.::||.|.
Zfish     4 RSVRAETRSRAKDDIKRVMAAIEKVRKWEKKWVTVGDTSLRIYKWVPVTEPKSDDKNKNKKKGKD 68

  Fly    61 E------------SSPGSAAVRRPPPGSGVTPVGGSKSDKENSQKGTPTPPQITPSYQGLTAEDS 113
            :            ||||...:.  ...|..:.:..|...|:.:...|...|:...:.|..:::..
Zfish    69 DKYGSEVTTPENSSSPGMMDMH--DDNSNQSSIADSSPLKQETSNNTSPAPEPMAASQNDSSDLK 131

  Fly   114 NTCFSVVSDSQGADFVS--------SMPFSEDSNSQG 142
            |..:.....|.|.|..|        ||....||.|||
Zfish   132 NDQYPSKQPSSGQDHKSEQNHCSSESMTSKRDSKSQG 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BCL7-likeNP_572562.1 BCL_N 2..49 CDD:282557 36/45 (80%)
bcl7aXP_005165419.1 BCL_N 4..50 CDD:282557 36/45 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 88 1.000 Domainoid score I7899
eggNOG 1 0.900 - - E1_KOG4095
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I5025
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1517597at2759
OrthoFinder 1 1.000 - - FOG0001798
OrthoInspector 1 1.000 - - otm25510
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12767
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2423
SonicParanoid 1 1.000 - - X1157
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.960

Return to query results.
Submit another query.