| Sequence 1: | NP_572562.1 | Gene: | BCL7-like / 31890 | FlyBaseID: | FBgn0026149 | Length: | 154 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001006872.1 | Gene: | bcl7a / 448642 | XenbaseID: | XB-GENE-5754603 | Length: | 231 | Species: | Xenopus tropicalis |
| Alignment Length: | 217 | Identity: | 74/217 - (34%) |
|---|---|---|---|
| Similarity: | 97/217 - (44%) | Gaps: | 68/217 - (31%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 3 RSVRAETRSRAKDDIKRVMQAVDKVRHWEKKWVTISDTTMKIYKWVPIASASEKKAKLE-SSPGS 66
Fly 67 AAVRRPPP----------------GSGVTPVGGSKS----------------------DKENSQK 93
Fly 94 GTPTPPQ---ITPSYQGLTAEDSNTCFSVVSDSQ---GADFVSSMPFSEDS-------------- 138
Fly 139 ------NSQGSDG---PVKRLK 151 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| BCL7-like | NP_572562.1 | BCL_N | 2..49 | CDD:282557 | 36/45 (80%) |
| bcl7a | NP_001006872.1 | BCL_N | 4..50 | CDD:368074 | 36/45 (80%) |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 62..231 | 35/159 (22%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 88 | 1.000 | Domainoid score | I7800 |
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 1 | 1.000 | - | - | ||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 101 | 1.000 | Inparanoid score | I4853 |
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1517597at2759 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0001798 | |
| OrthoInspector | 1 | 1.000 | - | - | otm49189 | |
| Panther | 1 | 1.100 | - | - | O | PTHR12767 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2423 |
| SonicParanoid | 1 | 1.000 | - | - | X1157 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 10 | 10.100 | |||||