DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BCL7-like and bcl7ba

DIOPT Version :9

Sequence 1:NP_572562.1 Gene:BCL7-like / 31890 FlyBaseID:FBgn0026149 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_998330.1 Gene:bcl7ba / 406444 ZFINID:ZDB-GENE-040426-2193 Length:203 Species:Danio rerio


Alignment Length:154 Identity:61/154 - (39%)
Similarity:81/154 - (52%) Gaps:27/154 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RSVRAETRSRAKDDIKRVMQAVDKVRHWEKKWVTISDTTMKIYKWVPIASASEKKAKLESSPGSA 67
            ||||||||||||||||:||.|:::||.|||||||:.||:::|:||||:....||: |.:.|.|..
Zfish     4 RSVRAETRSRAKDDIKKVMAAIERVRRWEKKWVTVGDTSLRIFKWVPVVDTKEKE-KSKVSVGGE 67

  Fly    68 AVRRPPPGSGVTPVGGSKSDK----------ENSQKGTPTPPQITPSYQGLTAEDSNTCFSVVSD 122
            ..|:..|..       ..||.          |||.:.:     ::.|||...|.||    |..|.
Zfish    68 MQRKNFPSE-------ESSDNACSVLLDFQDENSNQSS-----LSDSYQHKAAADS----SNNSS 116

  Fly   123 SQGADFVSSMPFSEDSNSQGSDGP 146
            ...::.||..|.|.|..:.....|
Zfish   117 PPASEPVSPAPQSLDYRTDDPQPP 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BCL7-likeNP_572562.1 BCL_N 2..49 CDD:282557 33/45 (73%)
bcl7baNP_998330.1 BCL_N 4..50 CDD:282557 33/45 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 55..80 7/32 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..148 15/56 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 88 1.000 Domainoid score I7899
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I5025
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1517597at2759
OrthoFinder 1 1.000 - - FOG0001798
OrthoInspector 1 1.000 - - otm25510
orthoMCL 1 0.900 - - OOG6_107907
Panther 1 1.100 - - O PTHR12767
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2423
SonicParanoid 1 1.000 - - X1157
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1111.000

Return to query results.
Submit another query.