DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BCL7-like and Bcl7c

DIOPT Version :9

Sequence 1:NP_572562.1 Gene:BCL7-like / 31890 FlyBaseID:FBgn0026149 Length:154 Species:Drosophila melanogaster
Sequence 2:XP_017444484.1 Gene:Bcl7c / 293514 RGDID:1308439 Length:240 Species:Rattus norvegicus


Alignment Length:117 Identity:50/117 - (42%)
Similarity:67/117 - (57%) Gaps:16/117 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RSVRAETRSRAKDDIKRVMQAVDKVRHWEKKWVTISDTTMKIYKWVPIASASEKKAKLESSPGSA 67
            |:||||||||||||||:||..::|||.|||:|||:.||:::|:||||:....|::.:........
  Rat     4 RTVRAETRSRAKDDIKKVMATIEKVRRWEKRWVTVGDTSLRIFKWVPVVDPQEEERRRAGGGAER 68

  Fly    68 AVRRPPPGSGVTPVGGSK------SDKENS----------QKGTPTPPQITP 103
            :..|...|.|.:|.||..      :..|||          ||||...|..||
  Rat    69 SRGRERRGRGTSPRGGGPLILLDLNADENSNQSFHSEGSLQKGTEPSPGGTP 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BCL7-likeNP_572562.1 BCL_N 2..49 CDD:282557 31/45 (69%)
Bcl7cXP_017444484.1 BCL_N 4..50 CDD:398405 31/45 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353502
Domainoid 1 1.000 88 1.000 Domainoid score I7747
eggNOG 1 0.900 - - E1_KOG4095
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I4945
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1517597at2759
OrthoFinder 1 1.000 - - FOG0001798
OrthoInspector 1 1.000 - - otm46107
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12767
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1157
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.