DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BCL7-like and Bcl7b

DIOPT Version :9

Sequence 1:NP_572562.1 Gene:BCL7-like / 31890 FlyBaseID:FBgn0026149 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_033875.2 Gene:Bcl7b / 12054 MGIID:1332238 Length:202 Species:Mus musculus


Alignment Length:165 Identity:63/165 - (38%)
Similarity:85/165 - (51%) Gaps:46/165 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RSVRAETRSRAKDDIKRVMQAVDKVRHWEKKWVTISDTTMKIYKWVPIASASEKKAKLESSPGSA 67
            ||||||||||||||||:||.|::|||.|||||||:.||:::|:||||:..:.||    |.|..:.
Mouse     4 RSVRAETRSRAKDDIKKVMAAIEKVRKWEKKWVTVGDTSLRIFKWVPVTDSKEK----EKSKSNN 64

  Fly    68 AVRRPPPG----------------------SGVTPVGGSKSDKENSQKGTPTPPQ---ITPSYQG 107
            ...|.|.|                      |.|:.|...|.|  :|...:|:|.|   ::|::  
Mouse    65 TAAREPNGFPSDASANSSLLLEFQDENSNQSSVSDVYQLKVD--SSTNSSPSPQQSESLSPAH-- 125

  Fly   108 LTAEDSNTCFSVVSDSQ----GADFVS--SMPFSE 136
              ..|..|     .|||    |.:.:.  |:|.||
Mouse   126 --TSDFRT-----DDSQPPTLGQEILEEPSLPASE 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BCL7-likeNP_572562.1 BCL_N 2..49 CDD:282557 34/45 (76%)
Bcl7bNP_033875.2 BCL_N 4..50 CDD:282557 34/45 (76%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..202 27/116 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 88 1.000 Domainoid score I7904
eggNOG 1 0.900 - - E1_KOG4095
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I5029
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001798
OrthoInspector 1 1.000 - - otm44015
orthoMCL 1 0.900 - - OOG6_107907
Panther 1 1.100 - - LDO PTHR12767
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2423
SonicParanoid 1 1.000 - - X1157
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.850

Return to query results.
Submit another query.